PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Araha.11221s0003.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Arabidopsis
Family G2-like
Protein Properties Length: 376aa    MW: 41605.9 Da    PI: 6.8003
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Araha.11221s0003.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like101.84.4e-32232287156
               G2-like   1 kprlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRla 56 
                           k+r++W+p+LH+rFv+a++ LGGs++AtPk+i+elmkv+gLt+++vkSHLQkYRl+
  Araha.11221s0003.1.p 232 KARRCWSPDLHRRFVQALQMLGGSQVATPKQIRELMKVDGLTNDEVKSHLQKYRLH 287
                           68****************************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129413.682229289IPR017930Myb domain
Gene3DG3DSA:1.10.10.601.6E-28230290IPR009057Homeodomain-like
SuperFamilySSF466891.55E-17230290IPR009057Homeodomain-like
TIGRFAMsTIGR015578.7E-27232287IPR006447Myb domain, plants
PfamPF002493.0E-7234285IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009266Biological Processresponse to temperature stimulus
GO:0009740Biological Processgibberellic acid mediated signaling pathway
GO:0010452Biological Processhistone H3-K36 methylation
GO:0048579Biological Processnegative regulation of long-day photoperiodism, flowering
GO:1903507Biological Processnegative regulation of nucleic acid-templated transcription
GO:0005634Cellular Componentnucleus
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 376 aa     Download sequence    Send to blast
MASSSELSLD CKPQSYSMLL KSFGDNFQSD PTTQKLEDLL SRLEQERLKI DAFKRELPLC  60
MQLLNNAVEV YKQQLEAYRA NSNNNNQSVA TRPVLEEFIP LRNQPEKTNN KGSNWMTTAQ  120
LWSQSETKPK NIDSTTDQSL PKDEISSSPK LGHFDAKQRN GNGAFLPFSK EQSLPELALS  180
TEVKRVSPTN EHTNGQDGND ESMINNDNNN NNNNNNSNSN GVSSTTSQSN RKARRCWSPD  240
LHRRFVQALQ MLGGSQVATP KQIRELMKVD GLTNDEVKSH LQKYRLHTRR PSPSPQTSGG  300
PGPHLVVLGG IWVPPEYTTA HGGTPTLYHH QLTDSATEEG KSSESGGGER KGLAALRDDG  360
EDQSNINGSE ITLKF*
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00261DAPTransfer from AT2G03500Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK2216620.0AK221662.1 Arabidopsis thaliana mRNA for hypothetical protein, complete cds, clone: RAFL09-70-E23.
GenBankAY0605590.0AY060559.1 Arabidopsis thaliana At2g03500/T4M8.7 mRNA, complete cds.
GenBankAY1336300.0AY133630.1 Arabidopsis thaliana At2g03500/T4M8.7 mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002875207.10.0myb family transcription factor
TrEMBLD7LQI30.0D7LQI3_ARALL; Myb family transcription factor
STRINGscaffold_500333.10.0(Arabidopsis lyrata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM71342843
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G03500.10.0G2-like family protein